Classified by application

Building Blocks and Intermediates

Thin Layer Chromatography

Screening Libraries

Bioactive Small Molecules

Dye and Bio-assay Reagents

Natural Products

Isotope Compounds

Peptides

CS-5665
PF-06291874
  • Cat. No.: 

    CS-5665
  • CAS No.: 

    1393124-08-7
CS-0028074
BETP
  • Cat. No.: 

    CS-0028074
  • CAS No.: 

    1371569-69-5
CS-0020879
GLP-1R Antagonist 1
  • Cat. No.: 

    CS-0020879
  • CAS No.: 

    488097-06-9
CS-5729
Adomeglivant
  • Cat. No.: 

    CS-5729
  • CAS No.: 

    1488363-78-5
CS-8038
HAEGTFT
  • Cat. No.: 

    CS-8038
  • CAS No.: 

    926018-95-3
CS-8036
HAEGTFTSD
  • Cat. No.: 

    CS-8036
  • CAS No.: 

    926018-45-3
CS-8061
HAEGTFTSDVS
  • Cat. No.: 

    CS-8061
  • CAS No.: 

    864915-61-7
CS-8060
Exendin-3/4 (59-86)
  • Cat. No.: 

    CS-8060
  • CAS No.: 

CS-8037
{Val1}-Exendin-3/4
  • Cat. No.: 

    CS-8037
  • CAS No.: 

CS-8039
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • Cat. No.: 

    CS-8039
  • CAS No.: 

CS-8051
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • Cat. No.: 

    CS-8051
  • CAS No.: 

CS-0103904
Lixisenatide acetate
  • Cat. No.: 

    CS-0103904
  • CAS No.: 

    1997361-87-1
CS-0028076
GLP-1(9-36)amide
  • Cat. No.: 

    CS-0028076
  • CAS No.: 

    161748-29-4
CS-7980
GLP-1 moiety from Dulaglutide
  • Cat. No.: 

    CS-7980
  • CAS No.: 

CS-0080402
Semaglutide TFA
  • Cat. No.: 

    CS-0080402
  • CAS No.: 

CS-0107005
Tirzepatide (hydrochloride)
  • Cat. No.: 

    CS-0107005
  • CAS No.: 

CS-0434447
V-0219
  • Cat. No.: 

    CS-0434447
  • CAS No.: 

    878453-71-5
CS-0066597
VU0453379
  • Cat. No.: 

    CS-0066597
  • CAS No.: 

    1638646-27-1
CS-0301
Glucagon receptor antagonists-1
  • Cat. No.: 

    CS-0301
  • CAS No.: 

    503559-84-0
CS-0028075
L-168049
  • Cat. No.: 

    CS-0028075
  • CAS No.: 

    191034-25-0